Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries) |
Domain d4mqkh_: 4mqk H: [235685] Other proteins in same PDB: d4mqka_, d4mqkc_, d4mqke_, d4mqkg_ automated match to d4mqkd_ complexed with cmo, hem; mutant |
PDB Entry: 4mqk (more details), 2.24 Å
SCOPe Domain Sequences for d4mqkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqkh_ a.1.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkvk ahgkkmltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgke ftpevqaswqkmvtgvasalssryh
Timeline for d4mqkh_: