Lineage for d4mqjb_ (4mqj B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475253Species Human (Homo sapiens) [TaxId:9606] [188371] (5 PDB entries)
  8. 1475256Domain d4mqjb_: 4mqj B: [235682]
    Other proteins in same PDB: d4mqja_, d4mqjc_, d4mqje_, d4mqjg_
    automated match to d4mqjf_
    complexed with cmo, hem, oxy

Details for d4mqjb_

PDB Entry: 4mqj (more details), 1.8 Å

PDB Description: structure of wild-type fetal human hemoglobin hbf
PDB Compounds: (B:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqjb_ a.1.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

SCOPe Domain Coordinates for d4mqjb_:

Click to download the PDB-style file with coordinates for d4mqjb_.
(The format of our PDB-style files is described here.)

Timeline for d4mqjb_: