SCOPe 2.05: Domain d4mmwa1: 4mmw A:1-126

Lineage for d4mmwa1 (4mmw A:1-126)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226505] (6 PDB entries)

8. Domain d4mmwa1: 4mmw A:1-126 [235677]
   Other proteins in same PDB: d4mmwa2, d4mmwb2
   automated match to d4mmwb1
   complexed with cl, llh, mg, pge, xyh

Details for d4mmwa1

PDB Entry: 4mmw, 1.65 Å

PDB Description: Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate

PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4mmwa1:

Sequence; same for both SEQRES and ATOM records:

>d4mmwa1 d.54.1.0 (A:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

Timeline for d4mmwa1:

• d4mmwa1 first appeared in SCOPe 2.03
  
• d4mmwa1 appears in SCOPe 2.04
  
• d4mmwa1 appears in SCOPe 2.06
  
• d4mmwa1 appears in the current release, SCOPe 2.08