SCOPe 2.06: Domain d4mi2c_: 4mi2 C:

Lineage for d4mi2c_ (4mi2 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)

8. Domain d4mi2c_: 4mi2 C: [235641]
   automated match to d4mi2b_

Details for d4mi2c_

PDB Entry: 4mi2, 2.3 Å

PDB Description: Crystal structure of putative Enoyl-CoA hydratase/isomerase from Mycobacterium abscessus

PDB Compounds: (C:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4mi2c_:

Sequence; same for both SEQRES and ATOM records:

>d4mi2c_ c.14.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
aavaysvnhagvaaivldrpeasnaldrtmktellqallaaggdpavravvmsaagknfc
vgqdlaehvealrddpahamdtvrehynpvlealdaikvpvvvaingacvgaglglalga
diriagqrakfgtaftgiglaadsalsaslprligasratamfllgdtidaptahtwglv
hevvdegspadvansvagrlaggptaafsevkellrrnavaplgdvlereasaqqrlgas
rdhsaaveaflakdkpvfvgr

Timeline for d4mi2c_:

• d4mi2c_ first appeared in SCOPe 2.03
  
• d4mi2c_ appears in SCOPe 2.05
  
• d4mi2c_ appears in SCOPe 2.07
  
• d4mi2c_ appears in the current release, SCOPe 2.08