Lineage for d4mh4b_ (4mh4 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564444Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2564445Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2564519Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 2564520Protein automated matches [190512] (5 species)
    not a true protein
  7. 2564524Species Burkholderia cenocepacia [TaxId:216591] [228400] (1 PDB entry)
  8. 2564526Domain d4mh4b_: 4mh4 B: [235628]
    automated match to d4mh4a_

Details for d4mh4b_

PDB Entry: 4mh4 (more details), 1.9 Å

PDB Description: crystal structure of osmc-like protein from burkholderia cenocepacia j2315
PDB Compounds: (B:) OsmC-like protein

SCOPe Domain Sequences for d4mh4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mh4b_ d.227.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
kiekvlytgkthttsggrdgaarssdgrldiqlsspgsagtgtnpeqlfaagwsacfiga
mqlaaraakvtlpadlavdaevdlgtagnayflqarlnvsvpglerdvaqrivdaahqtc
pyskatrgnidvdiria

SCOPe Domain Coordinates for d4mh4b_:

Click to download the PDB-style file with coordinates for d4mh4b_.
(The format of our PDB-style files is described here.)

Timeline for d4mh4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mh4a_