Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Labrenzia aggregata [TaxId:384765] [228392] (1 PDB entry) |
Domain d4mggh1: 4mgg H:1-127 [235624] Other proteins in same PDB: d4mgga2, d4mgga3, d4mggb2, d4mggc2, d4mggd2, d4mggd3, d4mgge2, d4mgge3, d4mggf2, d4mggf3, d4mggg2, d4mggh2, d4mggh3 automated match to d4mggf1 complexed with cl, mg, ni |
PDB Entry: 4mgg (more details), 2.2 Å
SCOPe Domain Sequences for d4mggh1:
Sequence, based on SEQRES records: (download)
>d4mggh1 d.54.1.0 (H:1-127) automated matches {Labrenzia aggregata [TaxId: 384765]} mkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsaylps yalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqp lytllgg
>d4mggh1 d.54.1.0 (H:1-127) automated matches {Labrenzia aggregata [TaxId: 384765]} mkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplsyalgvr sglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytllg g
Timeline for d4mggh1: