Lineage for d4mgga1 (4mgg A:-1-127)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905573Species Labrenzia aggregata [TaxId:384765] [228392] (1 PDB entry)
  8. 1905574Domain d4mgga1: 4mgg A:-1-127 [235614]
    Other proteins in same PDB: d4mgga2, d4mggb2, d4mggc2, d4mggd2, d4mgge2, d4mggf2, d4mggg2, d4mggh2
    automated match to d4mggf1
    complexed with cl, mg, ni

Details for d4mgga1

PDB Entry: 4mgg (more details), 2.2 Å

PDB Description: Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121
PDB Compounds: (A:) muconate lactonizing enzyme

SCOPe Domain Sequences for d4mgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mgga1 d.54.1.0 (A:-1-127) automated matches {Labrenzia aggregata [TaxId: 384765]}
shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
qplytllgg

SCOPe Domain Coordinates for d4mgga1:

Click to download the PDB-style file with coordinates for d4mgga1.
(The format of our PDB-style files is described here.)

Timeline for d4mgga1: