SCOPe 2.04: Domain d4mgga1: 4mgg A:-1-127

Lineage for d4mgga1 (4mgg A:-1-127)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Labrenzia aggregata [TaxId:384765] [228392] (1 PDB entry)

8. Domain d4mgga1: 4mgg A:-1-127 [235614]
   Other proteins in same PDB: d4mgga2, d4mggb2, d4mggc2, d4mggd2, d4mgge2, d4mggf2, d4mggg2, d4mggh2
   automated match to d4mggf1
   complexed with cl, mg, ni

Details for d4mgga1

PDB Entry: 4mgg, 2.2 Å

PDB Description: Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121

PDB Compounds: (A:) muconate lactonizing enzyme

SCOPe Domain Sequences for d4mgga1:

Sequence; same for both SEQRES and ATOM records:

>d4mgga1 d.54.1.0 (A:-1-127) automated matches {Labrenzia aggregata [TaxId: 384765]}
shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
qplytllgg

Timeline for d4mgga1:

• d4mgga1 first appeared in SCOPe 2.03
  
• d4mgga1 appears in SCOPe 2.05
  
• d4mgga1 appears in the current release, SCOPe 2.08