SCOPe 2.08: Domain d4mfgc1: 4mfg C:1-165

Lineage for d4mfgc1 (4mfg C:1-165)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [193268] (4 PDB entries)

8. Domain d4mfgc1: 4mfg C:1-165 [235612]
   Other proteins in same PDB: d4mfga2, d4mfgb2, d4mfgc2, d4mfgd2
   automated match to d4mfgd_
   complexed with mg, ni

Details for d4mfgc1

PDB Entry: 4mfg, 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of putative carbonic anhydrase from clostridium difficile.

PDB Compounds: (C:) Putative acyltransferase

SCOPe Domain Sequences for d4mfgc1:

Sequence; same for both SEQRES and ATOM records:

>d4mfgc1 b.81.1.0 (C:1-165) automated matches {Clostridium difficile [TaxId: 272563]}
mirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentniqdc
sivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtlits
nkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky

Timeline for d4mfgc1:

• d4mfgc1 first appeared in SCOPe 2.03, called d4mfgc_
  
• d4mfgc1 appears in SCOPe 2.07