Lineage for d4mfga1 (4mfg A:1-165)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814252Species Clostridium difficile [TaxId:272563] [193268] (4 PDB entries)
  8. 2814255Domain d4mfga1: 4mfg A:1-165 [235611]
    Other proteins in same PDB: d4mfga2, d4mfgb2, d4mfgc2, d4mfgd2
    automated match to d4mfgd_
    complexed with mg, ni

Details for d4mfga1

PDB Entry: 4mfg (more details), 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of putative carbonic anhydrase from clostridium difficile.
PDB Compounds: (A:) Putative acyltransferase

SCOPe Domain Sequences for d4mfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mfga1 b.81.1.0 (A:1-165) automated matches {Clostridium difficile [TaxId: 272563]}
mirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentniqdc
sivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtlits
nkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky

SCOPe Domain Coordinates for d4mfga1:

Click to download the PDB-style file with coordinates for d4mfga1.
(The format of our PDB-style files is described here.)

Timeline for d4mfga1: