Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [193268] (4 PDB entries) |
Domain d4mfga1: 4mfg A:1-165 [235611] Other proteins in same PDB: d4mfga2, d4mfgb2, d4mfgc2, d4mfgd2 automated match to d4mfgd_ complexed with mg, ni |
PDB Entry: 4mfg (more details), 2 Å
SCOPe Domain Sequences for d4mfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mfga1 b.81.1.0 (A:1-165) automated matches {Clostridium difficile [TaxId: 272563]} mirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentniqdc sivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtlits nkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky
Timeline for d4mfga1: