SCOPe 2.08: Domain d4mbzh1: 4mbz H:29-298

Lineage for d4mbzh1 (4mbz H:29-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein automated matches [191200] (13 species)
   not a true protein

7. Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)

8. Domain d4mbzh1: 4mbz H:29-298 [235588]
   Other proteins in same PDB: d4mbza2, d4mbzb2, d4mbzc2, d4mbzd2, d4mbze2, d4mbzf2, d4mbzg2, d4mbzh2, d4mbzi2, d4mbzj2
   automated match to d4mbxd_
   protein/DNA complex; complexed with ca, cl, edo, ipa

Details for d4mbzh1

PDB Entry: 4mbz, 1.75 Å

PDB Description: structure of b-lymphotropic polyomavirus vp1 in complex with 3'- sialyllactosamine

PDB Compounds: (H:) Major capsid protein VP1

SCOPe Domain Sequences for d4mbzh1:

Sequence, based on SEQRES records:

>d4mbzh1 b.121.6.1 (H:29-298) automated matches {Human polyomavirus 9 [TaxId: 943908]}
gvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdtlpcy
svaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqgt
tyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypvev
wcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadia
gvhtnysetqvwrglpryfnvtlrkrivkn

Sequence, based on observed residues (ATOM records):

>d4mbzh1 b.121.6.1 (H:29-298) automated matches {Human polyomavirus 9 [TaxId: 943908]}
gvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdtlpcy
svaviklpllnedmtctilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqgtt
yhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypvevw
cpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadiag
vhtnysetqvwrglpryfnvtlrkrivkn

Timeline for d4mbzh1:

• d4mbzh1 first appeared in SCOPe 2.03, called d4mbzh_
  
• d4mbzh1 was called d4mbzh_ in SCOPe 2.07