Lineage for d4mbzf1 (4mbz F:29-298)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823375Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)
  8. 2823411Domain d4mbzf1: 4mbz F:29-298 [235587]
    Other proteins in same PDB: d4mbza2, d4mbzb2, d4mbzc2, d4mbzd2, d4mbze2, d4mbzf2, d4mbzg2, d4mbzh2, d4mbzi2, d4mbzj2
    automated match to d4mbxd_
    protein/DNA complex; complexed with ca, cl, edo, ipa

Details for d4mbzf1

PDB Entry: 4mbz (more details), 1.75 Å

PDB Description: structure of b-lymphotropic polyomavirus vp1 in complex with 3'- sialyllactosamine
PDB Compounds: (F:) Major capsid protein VP1

SCOPe Domain Sequences for d4mbzf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbzf1 b.121.6.1 (F:29-298) automated matches {Human polyomavirus 9 [TaxId: 943908]}
gvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdtlpcy
svaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqgt
tyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypvev
wcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadia
gvhtnysetqvwrglpryfnvtlrkrivkn

SCOPe Domain Coordinates for d4mbzf1:

Click to download the PDB-style file with coordinates for d4mbzf1.
(The format of our PDB-style files is described here.)

Timeline for d4mbzf1: