Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries) |
Domain d4mbzf1: 4mbz F:29-298 [235587] Other proteins in same PDB: d4mbza2, d4mbzb2, d4mbzc2, d4mbzd2, d4mbze2, d4mbzf2, d4mbzg2, d4mbzh2, d4mbzi2, d4mbzj2 automated match to d4mbxd_ protein/DNA complex; complexed with ca, cl, edo, ipa |
PDB Entry: 4mbz (more details), 1.75 Å
SCOPe Domain Sequences for d4mbzf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mbzf1 b.121.6.1 (F:29-298) automated matches {Human polyomavirus 9 [TaxId: 943908]} gvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdtlpcy svaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqgt tyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypvev wcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadia gvhtnysetqvwrglpryfnvtlrkrivkn
Timeline for d4mbzf1: