SCOPe 2.08: Domain d4mbyc1: 4mby C:29-299

Lineage for d4mbyc1 (4mby C:29-299)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein automated matches [191200] (13 species)
   not a true protein

7. Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)

8. Domain d4mbyc1: 4mby C:29-299 [235574]
   Other proteins in same PDB: d4mbya2, d4mbyb2, d4mbyc2, d4mbyd2, d4mbye2, d4mbyf2, d4mbyg2, d4mbyh2, d4mbyi2, d4mbyj2
   automated match to d4mbxd_
   protein/DNA complex; complexed with ca, cl, edo, ipa

Details for d4mbyc1

PDB Entry: 4mby, 1.48 Å

PDB Description: structure of b-lymphotropic polyomavirus vp1 in complex with 3'- sialyllactose

PDB Compounds: (C:) Major capsid protein VP1

SCOPe Domain Sequences for d4mbyc1:

Sequence; same for both SEQRES and ATOM records:

>d4mbyc1 b.121.6.1 (C:29-299) automated matches {Human polyomavirus 9 [TaxId: 943908]}
gvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdtlpcy
svaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqgt
tyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypvev
wcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadia
gvhtnysetqvwrglpryfnvtlrkrivknp

Timeline for d4mbyc1:

• d4mbyc1 first appeared in SCOPe 2.03, called d4mbyc_
  
• d4mbyc1 was called d4mbyc_ in SCOPe 2.07