Lineage for d4m9ce_ (4m9c E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329958Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329959Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1330233Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1330234Protein automated matches [190967] (25 species)
    not a true protein
  7. 1330235Species Acinetobacter baumannii [TaxId:470] [193329] (2 PDB entries)
  8. 1330241Domain d4m9ce_: 4m9c E: [235554]
    automated match to d4m9cd_

Details for d4m9ce_

PDB Entry: 4m9c (more details), 2.1 Å

PDB Description: weei from acinetobacter baumannii aye
PDB Compounds: (E:) Bacterial transferase hexapeptide (Three repeats) family protein

SCOPe Domain Sequences for d4m9ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9ce_ b.81.1.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 470]}
tmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskpa
dhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftcltsn
ikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkpl
iigkgaivgmgavvtksvpagvtvvgnparil

SCOPe Domain Coordinates for d4m9ce_:

Click to download the PDB-style file with coordinates for d4m9ce_.
(The format of our PDB-style files is described here.)

Timeline for d4m9ce_: