Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (4 PDB entries) |
Domain d4m9bb_: 4m9b B: [235552] automated match to d4m9wa_ complexed with na |
PDB Entry: 4m9b (more details), 1.6 Å
SCOPe Domain Sequences for d4m9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9bb_ d.129.3.0 (B:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht kgdakpdeeelkkgkakgeglfraiegyvlanptqy
Timeline for d4m9bb_: