Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:242231] [235544] (2 PDB entries) |
Domain d4m98a_: 4m98 A: [235546] automated match to d4m9cd_ |
PDB Entry: 4m98 (more details), 1.67 Å
SCOPe Domain Sequences for d4m98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m98a_ b.81.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} nrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspeq fditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqagsv lkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgvt agagavivcdipdgmtvagnpakpl
Timeline for d4m98a_: