SCOPe 2.08: Domain d4m87a_: 4m87 A:

Lineage for d4m87a_ (4m87 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:272831] [228105] (3 PDB entries)

8. Domain d4m87a_: 4m87 A: [235543]
   automated match to d4m89a_
   complexed with nad

Details for d4m87a_

PDB Entry: 4m87, 2.25 Å

PDB Description: Crystal Structure of Enoyl-Acyl Carrier Protein Reductase (FabI) from Neisseria meningitidis in complex with NAD+

PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4m87a_:

Sequence; same for both SEQRES and ATOM records:

>d4m87a_ c.2.1.2 (A:) automated matches {Neisseria meningitidis [TaxId: 272831]}
gflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselvf
rcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheisa
yslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgke
gircngisagpiktlaasgiadfgkllghvaahnplrrnvtieevgntaafllsdlssgi
tgeityvdggysinals

Timeline for d4m87a_:

• d4m87a_ first appeared in SCOPe 2.03
  
• d4m87a_ appears in SCOPe 2.07