Lineage for d4m55e_ (4m55 E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107963Domain d4m55e_: 4m55 E: [235528]
    automated match to d4m55d_
    complexed with nad, pop, so4, udp

Details for d4m55e_

PDB Entry: 4m55 (more details), 2.86 Å

PDB Description: crystal structure of human udp-xylose synthase r236h substitution
PDB Compounds: (E:) UDP-glucuronic acid decarboxylase 1

SCOPe Domain Sequences for d4m55e_:

Sequence, based on SEQRES records: (download)

>d4m55e_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl
yievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevygdp
evhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgprmhmn
dgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpeeh
tilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklm

Sequence, based on observed residues (ATOM records): (download)

>d4m55e_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl
yievdqiyhlaspnpiktlktntigtlnmlglakrvgarlllastsvaetmcyaymkqeg
vevrvarifntfqyvsdlvnglvalmnsnvsspvnldikkaklm

SCOPe Domain Coordinates for d4m55e_:

Click to download the PDB-style file with coordinates for d4m55e_.
(The format of our PDB-style files is described here.)

Timeline for d4m55e_: