SCOPe 2.05: Domain d4m55e_: 4m55 E:

Lineage for d4m55e_ (4m55 E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)

8. Domain d4m55e_: 4m55 E: [235528]
   automated match to d4m55d_
   complexed with nad, pop, so4, udp

Details for d4m55e_

PDB Entry: 4m55, 2.86 Å

PDB Description: crystal structure of human udp-xylose synthase r236h substitution

PDB Compounds: (E:) UDP-glucuronic acid decarboxylase 1

SCOPe Domain Sequences for d4m55e_:

Sequence, based on SEQRES records:

>d4m55e_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl
yievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevygdp
evhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgprmhmn
dgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpeeh
tilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklm

Sequence, based on observed residues (ATOM records):

>d4m55e_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl
yievdqiyhlaspnpiktlktntigtlnmlglakrvgarlllastsvaetmcyaymkqeg
vevrvarifntfqyvsdlvnglvalmnsnvsspvnldikkaklm

Timeline for d4m55e_:

• d4m55e_ first appeared in SCOPe 2.03
  
• d4m55e_ appears in SCOPe 2.04
  
• d4m55e_ appears in SCOPe 2.06
  
• d4m55e_ appears in the current release, SCOPe 2.08