SCOPe 2.06: Domain d4lyea_: 4lye A:

Lineage for d4lyea_ (4lye A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Sphingomonas wittichii [TaxId:392499] [227977] (5 PDB entries)

8. Domain d4lyea_: 4lye A: [235520]
   automated match to d4lxha_
   complexed with hpk; mutant

Details for d4lyea_

PDB Entry: 4lye, 2.33 Å

PDB Description: crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda

PDB Compounds: (A:) MCP Hydrolase

SCOPe Domain Sequences for d4lyea_:

Sequence; same for both SEQRES and ATOM records:

>d4lyea_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]}
mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
aipqaighvfpncghwvmieypeefctqtlhffgkl

Timeline for d4lyea_:

• d4lyea_ first appeared in SCOPe 2.03
  
• d4lyea_ appears in SCOPe 2.05
  
• d4lyea_ appears in SCOPe 2.07
  
• d4lyea_ appears in the current release, SCOPe 2.08