Lineage for d4lx8a1 (4lx8 A:6-128)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114998Protein automated matches [190177] (7 species)
    not a true protein
  7. 2115056Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)
  8. 2115058Domain d4lx8a1: 4lx8 A:6-128 [235518]
    Other proteins in same PDB: d4lx8a2
    automated match to d4hnsa_
    complexed with mg

Details for d4lx8a1

PDB Entry: 4lx8 (more details), 2.2 Å

PDB Description: Crystal structure (2.2A) of Mg2+ bound CheY3 of Vibrio cholerae
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4lx8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lx8a1 c.23.1.1 (A:6-128) automated matches {Vibrio cholerae [TaxId: 666]}
nknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmpg
mqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekldk
ife

SCOPe Domain Coordinates for d4lx8a1:

Click to download the PDB-style file with coordinates for d4lx8a1.
(The format of our PDB-style files is described here.)

Timeline for d4lx8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lx8a2