Lineage for d4lsul1 (4lsu L:2-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765817Domain d4lsul1: 4lsu L:2-107 [235514]
    Other proteins in same PDB: d4lsul2
    automated match to d2mcg11
    complexed with cl, edo, epe, nag

Details for d4lsul1

PDB Entry: 4lsu (more details), 2.3 Å

PDB Description: Crystal structure of broadly and potently neutralizing antibody VRC-PG20 in complex with HIV-1 clade A/E 93TH057 gp120
PDB Compounds: (L:) light chain of antibody vrc-pg20

SCOPe Domain Sequences for d4lsul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsul1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsvsgspgqsitlsctgastsvawyqqyadkaprlivfdgnkrpsdissrfsgs
qsggtasltisglqsedeayyhcnafeffgggtkltvls

SCOPe Domain Coordinates for d4lsul1:

Click to download the PDB-style file with coordinates for d4lsul1.
(The format of our PDB-style files is described here.)

Timeline for d4lsul1: