SCOPe 2.04: Domain d4lsql2: 4lsq L:108-213

Lineage for d4lsql2 (4lsq L:108-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4lsql2: 4lsq L:108-213 [235511]
   Other proteins in same PDB: d4lsql1
   automated match to d1n0xl2
   complexed with bu3, cd, cl, na, nag; mutant

Details for d4lsql2

PDB Entry: 4lsq, 2.25 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc- ch31 in complex with hiv-1 clade a/e gp120 93th057 with loop d and loop v5 from clade a strain 3415_v1_c1

PDB Compounds: (L:) light chain of antibody vrc-ch31 with n70d mutation

SCOPe Domain Sequences for d4lsql2:

Sequence; same for both SEQRES and ATOM records:

>d4lsql2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4lsql2:

• d4lsql2 first appeared in SCOPe 2.03
  
• d4lsql2 appears in SCOPe 2.05
  
• d4lsql2 appears in the current release, SCOPe 2.08