Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
Protein automated matches [227028] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228700] (5 PDB entries) |
Domain d4lnoc2: 4lno C:105-444 [235492] Other proteins in same PDB: d4lnoa1, d4lnob1, d4lnoc1, d4lnod1, d4lnoe1, d4lnof1 automated match to d4lnkc2 complexed with gln, mg |
PDB Entry: 4lno (more details), 2.9 Å
SCOPe Domain Sequences for d4lnoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnoc2 d.128.1.0 (C:105-444) automated matches {Bacillus subtilis [TaxId: 1423]} egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy
Timeline for d4lnoc2: