Lineage for d4lnob1 (4lno B:2-104)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639568Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 1639693Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 1639694Protein automated matches [226862] (3 species)
    not a true protein
  7. 1639695Species Bacillus subtilis [TaxId:1423] [228697] (5 PDB entries)
  8. 1639709Domain d4lnob1: 4lno B:2-104 [235489]
    Other proteins in same PDB: d4lnoa2, d4lnob2, d4lnoc2, d4lnod2, d4lnoe2, d4lnof2
    automated match to d4lnkc1
    complexed with gln, mg

Details for d4lnob1

PDB Entry: 4lno (more details), 2.9 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: form two of GS-1
PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d4lnob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnob1 d.15.9.0 (B:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d4lnob1:

Click to download the PDB-style file with coordinates for d4lnob1.
(The format of our PDB-style files is described here.)

Timeline for d4lnob1: