Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
Protein automated matches [227028] (6 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries) |
Domain d4lnkb2: 4lnk B:105-444 [235482] Other proteins in same PDB: d4lnka1, d4lnkb1, d4lnkc1, d4lnkd1, d4lnke1, d4lnkf1 automated match to d4lnkc2 complexed with adp, glu, mg, so4 |
PDB Entry: 4lnk (more details), 2.87 Å
SCOPe Domain Sequences for d4lnkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnkb2 d.128.1.0 (B:105-444) automated matches {Bacillus subtilis [TaxId: 1423]} egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy
Timeline for d4lnkb2: