Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
Protein automated matches [227028] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228700] (4 PDB entries) |
Domain d4lnil2: 4lni L:105-444 [235478] Other proteins in same PDB: d4lnia1, d4lnib1, d4lnic1, d4lnid1, d4lnie1, d4lnif1, d4lnig1, d4lnih1, d4lnii1, d4lnij1, d4lnik1, d4lnil1 automated match to d4lnkc2 complexed with adp, mg, p3s |
PDB Entry: 4lni (more details), 2.58 Å
SCOPe Domain Sequences for d4lnil2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnil2 d.128.1.0 (L:105-444) automated matches {Bacillus subtilis [TaxId: 1423]} egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy
Timeline for d4lnil2: