![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (3 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [228697] (4 PDB entries) |
![]() | Domain d4lnij1: 4lni J:4-104 [235475] Other proteins in same PDB: d4lnia2, d4lnib2, d4lnic2, d4lnid2, d4lnie2, d4lnif2, d4lnig2, d4lnih2, d4lnii2, d4lnij2, d4lnik2, d4lnil2 automated match to d4lnkc1 complexed with adp, mg, p3s |
PDB Entry: 4lni (more details), 2.58 Å
SCOPe Domain Sequences for d4lnij1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnij1 d.15.9.0 (J:4-104) automated matches {Bacillus subtilis [TaxId: 1423]} ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d4lnij1: