SCOPe 2.03: Domain d4lnie2: 4lni E:105-444

Lineage for d4lnie2 (4lni E:105-444)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228700] (4 PDB entries)

8. Domain d4lnie2: 4lni E:105-444 [235466]
   Other proteins in same PDB: d4lnia1, d4lnib1, d4lnic1, d4lnid1, d4lnie1, d4lnif1, d4lnig1, d4lnih1, d4lnii1, d4lnij1, d4lnik1, d4lnil1
   automated match to d4lnkc2
   complexed with adp, mg, p3s

Details for d4lnie2

PDB Entry: 4lni, 2.58 Å

PDB Description: b. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex

PDB Compounds: (E:) glutamine synthetase

SCOPe Domain Sequences for d4lnie2:

Sequence; same for both SEQRES and ATOM records:

>d4lnie2 d.128.1.0 (E:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

Timeline for d4lnie2:

• d4lnie2 is new in SCOPe 2.03-stable
  
• d4lnie2 appears in SCOPe 2.04
  
• d4lnie2 appears in the current release, SCOPe 2.08