Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228697] (5 PDB entries) |
Domain d4lnid1: 4lni D:2-104 [235463] Other proteins in same PDB: d4lnia2, d4lnib2, d4lnic2, d4lnid2, d4lnie2, d4lnif2, d4lnig2, d4lnih2, d4lnii2, d4lnij2, d4lnik2, d4lnil2 automated match to d4lnkc1 complexed with adp, mg, p3s |
PDB Entry: 4lni (more details), 2.58 Å
SCOPe Domain Sequences for d4lnid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnid1 d.15.9.0 (D:2-104) automated matches {Bacillus subtilis [TaxId: 1423]} akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d4lnid1: