SCOPe 2.03: Domain d4lnib1: 4lni B:2-104

Lineage for d4lnib1 (4lni B:2-104)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228697] (4 PDB entries)

8. Domain d4lnib1: 4lni B:2-104 [235459]
   Other proteins in same PDB: d4lnia2, d4lnib2, d4lnic2, d4lnid2, d4lnie2, d4lnif2, d4lnig2, d4lnih2, d4lnii2, d4lnij2, d4lnik2, d4lnil2
   automated match to d4lnkc1
   complexed with adp, mg, p3s

Details for d4lnib1

PDB Entry: 4lni, 2.58 Å

PDB Description: b. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex

PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d4lnib1:

Sequence; same for both SEQRES and ATOM records:

>d4lnib1 d.15.9.0 (B:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

Timeline for d4lnib1:

• d4lnib1 is new in SCOPe 2.03-stable
  
• d4lnib1 appears in SCOPe 2.04
  
• d4lnib1 appears in the current release, SCOPe 2.08