Lineage for d4lnfj2 (4lnf J:105-444)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538589Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2538590Protein automated matches [227028] (6 species)
    not a true protein
  7. 2538591Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2538637Domain d4lnfj2: 4lnf J:105-444 [235454]
    Other proteins in same PDB: d4lnfa1, d4lnfb1, d4lnfc1, d4lnfd1, d4lnfe1, d4lnff1, d4lnfg1, d4lnfh1, d4lnfi1, d4lnfj1, d4lnfk1, d4lnfl1
    automated match to d4lnkc2
    complexed with gln, mg, po4

Details for d4lnfj2

PDB Entry: 4lnf (more details), 2.95 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-Q
PDB Compounds: (J:) glutamine synthetase

SCOPe Domain Sequences for d4lnfj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnfj2 d.128.1.0 (J:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d4lnfj2:

Click to download the PDB-style file with coordinates for d4lnfj2.
(The format of our PDB-style files is described here.)

Timeline for d4lnfj2: