Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (4 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228697] (5 PDB entries) |
Domain d4lnfh1: 4lnf H:2-104 [235447] Other proteins in same PDB: d4lnfa2, d4lnfb2, d4lnfc2, d4lnfd2, d4lnfe2, d4lnff2, d4lnfg2, d4lnfh2, d4lnfi2, d4lnfj2, d4lnfk2, d4lnfl2 automated match to d4lnkc1 complexed with gln, mg, po4 |
PDB Entry: 4lnf (more details), 2.95 Å
SCOPe Domain Sequences for d4lnfh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnfh1 d.15.9.0 (H:2-104) automated matches {Bacillus subtilis [TaxId: 1423]} akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d4lnfh1: