![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (5 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries) |
![]() | Domain d4lnfe2: 4lnf E:105-444 [235442] Other proteins in same PDB: d4lnfa1, d4lnfb1, d4lnfc1, d4lnfd1, d4lnfe1, d4lnff1, d4lnfg1, d4lnfh1, d4lnfi1, d4lnfj1, d4lnfk1, d4lnfl1 automated match to d4lnkc2 complexed with gln, mg, po4 |
PDB Entry: 4lnf (more details), 2.95 Å
SCOPe Domain Sequences for d4lnfe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnfe2 d.128.1.0 (E:105-444) automated matches {Bacillus subtilis [TaxId: 1423]} egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy
Timeline for d4lnfe2: