Lineage for d4lnfe1 (4lnf E:2-104)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541920Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2542045Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2542046Protein automated matches [226862] (5 species)
    not a true protein
  7. 2542047Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)
  8. 2542088Domain d4lnfe1: 4lnf E:2-104 [235441]
    Other proteins in same PDB: d4lnfa2, d4lnfb2, d4lnfc2, d4lnfd2, d4lnfe2, d4lnff2, d4lnfg2, d4lnfh2, d4lnfi2, d4lnfj2, d4lnfk2, d4lnfl2
    automated match to d4lnkc1
    complexed with gln, mg, po4

Details for d4lnfe1

PDB Entry: 4lnf (more details), 2.95 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-Q
PDB Compounds: (E:) glutamine synthetase

SCOPe Domain Sequences for d4lnfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnfe1 d.15.9.0 (E:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d4lnfe1:

Click to download the PDB-style file with coordinates for d4lnfe1.
(The format of our PDB-style files is described here.)

Timeline for d4lnfe1: