SCOPe 2.06: Domain d4lnfb2: 4lnf B:105-444

Lineage for d4lnfb2 (4lnf B:105-444)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)

8. Domain d4lnfb2: 4lnf B:105-444 [235434]
   Other proteins in same PDB: d4lnfa1, d4lnfb1, d4lnfc1, d4lnfd1, d4lnfe1, d4lnff1, d4lnfg1, d4lnfh1, d4lnfi1, d4lnfj1, d4lnfk1, d4lnfl1
   automated match to d4lnkc2
   complexed with gln, mg, po4

Details for d4lnfb2

PDB Entry: 4lnf, 2.95 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-Q

PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d4lnfb2:

Sequence; same for both SEQRES and ATOM records:

>d4lnfb2 d.128.1.0 (B:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

Timeline for d4lnfb2:

• d4lnfb2 first appeared in SCOPe 2.03
  
• d4lnfb2 appears in SCOPe 2.05
  
• d4lnfb2 appears in SCOPe 2.07
  
• d4lnfb2 appears in the current release, SCOPe 2.08