Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d4lkja_: 4lkj A: [235396] Other proteins in same PDB: d4lkjb_ automated match to d4lkia_ complexed with nag; mutant |
PDB Entry: 4lkj (more details), 2.8 Å
SCOPe Domain Sequences for d4lkja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkja_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]} iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq tklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq rslllatgmknvpe
Timeline for d4lkja_: