Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d4lhug2: 4lhu G:126-236 [235378] Other proteins in same PDB: d4lhua1, d4lhua2, d4lhub1, d4lhub2, d4lhud1, d4lhud2, d4lhug1 automated match to d4lfhg2 complexed with bma, cl, jls, mg, nag |
PDB Entry: 4lhu (more details), 2.87 Å
SCOPe Domain Sequences for d4lhug2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhug2 b.1.1.2 (G:126-236) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihwqekksntilgsqegn tmktndtymkfswltvpeesldkehrcivrhennkngvdqeiifppiktdv
Timeline for d4lhug2: