Lineage for d4lfnc_ (4lfn C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395541Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 1395542Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 1395594Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 1395595Protein automated matches [191196] (7 species)
    not a true protein
  7. 1395613Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries)
  8. 1395624Domain d4lfnc_: 4lfn C: [235366]
    automated match to d4lfma_
    complexed with rbl

Details for d4lfnc_

PDB Entry: 4lfn (more details), 1.65 Å

PDB Description: crystal structure of d-galactose-6-phosphate isomerase in complex with d-ribulose
PDB Compounds: (C:) Galactose-6-phosphate isomerase subunit A

SCOPe Domain Sequences for d4lfnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lfnc_ c.121.1.0 (C:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]}
mdviigadkdgfamkeqvkkyleehqyrvadvtpepaedfvesslavtkkllnsdahkai
mfdrygvgsamasnkvkgmvtavveeentahmtaehngakaiaigtgitgydralviiqr
yldteyaggrhqirldmlekmi

SCOPe Domain Coordinates for d4lfnc_:

Click to download the PDB-style file with coordinates for d4lfnc_.
(The format of our PDB-style files is described here.)

Timeline for d4lfnc_: