SCOPe 2.04: Domain d4lfhd1: 4lfh D:5-120

Lineage for d4lfhd1 (4lfh D:5-120)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4lfhd1: 4lfh D:5-120 [235360]
   Other proteins in same PDB: d4lfhg2
   automated match to d4lhud1
   complexed with act, na

Details for d4lfhd1

PDB Entry: 4lfh, 2.3 Å

PDB Description: crystal structure of 9c2 tcr

PDB Compounds: (D:) 9C2 TCR delta chain

SCOPe Domain Sequences for d4lfhd1:

Sequence; same for both SEQRES and ATOM records:

>d4lfhd1 b.1.1.0 (D:5-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg
rysvnfkkaaksvaltisalqledsakyfcalgdpgglntdklifgkgtrvtvepr

Timeline for d4lfhd1:

• d4lfhd1 first appeared in SCOPe 2.03
  
• d4lfhd1 appears in SCOPe 2.05
  
• d4lfhd1 appears in the current release, SCOPe 2.08