SCOPe 2.06: Domain d4lcwh2: 4lcw H:117-242

Lineage for d4lcwh2 (4lcw H:117-242)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4lcwh2: 4lcw H:117-242 [235341]
   Other proteins in same PDB: d4lcwa1, d4lcwa3, d4lcwb_, d4lcwc1, d4lcwc3, d4lcwd2, d4lcwf_, d4lcwg2
   automated match to d4l4vh2
   complexed with 1vy, gol

Details for d4lcwh2

PDB Entry: 4lcw, 2.4 Å

PDB Description: The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH

PDB Compounds: (H:) MAIT T cell receptor beta chain

SCOPe Domain Sequences for d4lcwh2:

Sequence; same for both SEQRES and ATOM records:

>d4lcwh2 b.1.1.0 (H:117-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawg

Timeline for d4lcwh2:

• d4lcwh2 first appeared in SCOPe 2.03
  
• d4lcwh2 appears in SCOPe 2.05
  
• d4lcwh2 appears in SCOPe 2.07
  
• d4lcwh2 appears in the current release, SCOPe 2.08