Lineage for d4lcwc1 (4lcw C:0-178)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1898167Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1898168Protein automated matches [226842] (4 species)
    not a true protein
  7. 1898181Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)
  8. 1898212Domain d4lcwc1: 4lcw C:0-178 [235338]
    Other proteins in same PDB: d4lcwa2, d4lcwb_, d4lcwc2, d4lcwd1, d4lcwd2, d4lcwe1, d4lcwe2, d4lcwf_, d4lcwg1, d4lcwg2, d4lcwh1, d4lcwh2
    automated match to d4lcwa1
    complexed with 1vy, gol

Details for d4lcwc1

PDB Entry: 4lcw (more details), 2.4 Å

PDB Description: The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4lcwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcwc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqaeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4lcwc1:

Click to download the PDB-style file with coordinates for d4lcwc1.
(The format of our PDB-style files is described here.)

Timeline for d4lcwc1: