Lineage for d4ld5f_ (4ld5 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723175Species Staphylococcus aureus [TaxId:1280] [193082] (6 PDB entries)
  8. 1723185Domain d4ld5f_: 4ld5 F: [235332]
    automated match to d4ld5d_
    complexed with so4; mutant

Details for d4ld5f_

PDB Entry: 4ld5 (more details), 2.4 Å

PDB Description: Crystal structure of MepR Q18P mutant from multidrug resistant S. aureus clinical isolate
PDB Compounds: (F:) MepR

SCOPe Domain Sequences for d4ld5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ld5f_ a.4.5.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]}
meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
eeeneqmkanltkmlsslq

SCOPe Domain Coordinates for d4ld5f_:

Click to download the PDB-style file with coordinates for d4ld5f_.
(The format of our PDB-style files is described here.)

Timeline for d4ld5f_: