SCOPe 2.06: Domain d4lcwg2: 4lcw G:111-198

Lineage for d4lcwg2 (4lcw G:111-198)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4lcwg2: 4lcw G:111-198 [235328]
   Other proteins in same PDB: d4lcwa1, d4lcwa2, d4lcwa3, d4lcwb_, d4lcwc1, d4lcwc2, d4lcwc3, d4lcwd1, d4lcwe1, d4lcwe2, d4lcwf_, d4lcwg1, d4lcwh1, d4lcwh2
   automated match to d4l4vg2
   complexed with 1vy, gol

Details for d4lcwg2

PDB Entry: 4lcw, 2.4 Å

PDB Description: The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH

PDB Compounds: (G:) MAIT T cell receptor alpha chain

SCOPe Domain Sequences for d4lcwg2:

Sequence, based on SEQRES records:

>d4lcwg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d4lcwg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnf
acanafnnsiipedtffp

Timeline for d4lcwg2:

• d4lcwg2 first appeared in SCOPe 2.03
  
• d4lcwg2 appears in SCOPe 2.05
  
• d4lcwg2 appears in SCOPe 2.07
  
• d4lcwg2 appears in the current release, SCOPe 2.08