Lineage for d4lash_ (4las H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d4lash_: 4las H: [235322]
    automated match to d4larh_
    complexed with 1wf

Details for d4lash_

PDB Entry: 4las (more details), 2.3299999999999996 Å

PDB Description: crystal structure of a therapeutic single chain antibody in complex with 4-hydroxymethamphetamine
PDB Compounds: (H:) Single chain antibody fragment scFv6H4

SCOPe Domain Sequences for d4lash_:

Sequence, based on SEQRES records: (download)

>d4lash_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvsggg
gsggggsggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklw
iystsnlasgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleik
ra

Sequence, based on observed residues (ATOM records): (download)

>d4lash_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvsggg
gsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnlasg
vparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra

SCOPe Domain Coordinates for d4lash_ are not available.

Timeline for d4lash_: