Lineage for d4l9ta_ (4l9t A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260280Species Staphylococcus aureus [TaxId:1280] [193082] (5 PDB entries)
  8. 1260283Domain d4l9ta_: 4l9t A: [235311]
    automated match to d4l9va_
    complexed with so4; mutant

Details for d4l9ta_

PDB Entry: 4l9t (more details), 1.79 Å

PDB Description: crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate
PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d4l9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l9ta_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
meftysylfrmishemkqkadqkleqlditneqghtlgylyahqqdgltqndiakalqrt
gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
eeeneqmkanltkmlsslqh

SCOPe Domain Coordinates for d4l9ta_:

Click to download the PDB-style file with coordinates for d4l9ta_.
(The format of our PDB-style files is described here.)

Timeline for d4l9ta_:

  • d4l9ta_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d4l9ta_ appears in SCOPe 2.04
  • d4l9ta_ appears in the current release, SCOPe 2.07, called d4l9ta1