Lineage for d4l4tc1 (4l4t C:0-178)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1642705Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1642706Protein automated matches [226842] (4 species)
    not a true protein
  7. 1642719Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries)
  8. 1642727Domain d4l4tc1: 4l4t C:0-178 [235262]
    Other proteins in same PDB: d4l4ta2, d4l4tb_, d4l4tc2, d4l4td1, d4l4td2, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4tg2, d4l4th1, d4l4th2
    automated match to d1agda2
    complexed with 6fp

Details for d4l4tc1

PDB Entry: 4l4t (more details), 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4tc1:

Sequence, based on SEQRES records: (download)

>d4l4tc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d4l4tc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwer
ytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfli
fnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4l4tc1:

Click to download the PDB-style file with coordinates for d4l4tc1.
(The format of our PDB-style files is described here.)

Timeline for d4l4tc1: