Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d4kuce_: 4kuc E: [235236] Other proteins in same PDB: d4kuca_, d4kuci_ automated match to d4kucd1 protein/RNA complex |
PDB Entry: 4kuc (more details), 2.79 Å
SCOPe Domain Sequences for d4kuce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kuce_ b.1.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaslavslgqratisyrasksvsymhwnqqkpgqpprlliylgsnlesgvgar fsgsgsgtdftlnihpveeedaatyycqhkreypptfgqgtkveikrtv
Timeline for d4kuce_:
View in 3D Domains from other chains: (mouse over for more information) d4kuca_, d4kucd1, d4kucd2, d4kuci_ |