SCOPe 2.03: Domain d4ksob_: 4kso B:

Lineage for d4ksob_ (4kso B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein automated matches [190797] (4 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [235225] (1 PDB entry)

8. Domain d4ksob_: 4kso B: [235226]
   automated match to d2qkeb_

Details for d4ksob_

PDB Entry: 4kso, 2.62 Å

PDB Description: Crystal Structure of Circadian clock protein KaiB from S.Elongatus

PDB Compounds: (B:) Circadian clock protein kaiB

SCOPe Domain Sequences for d4ksob_:

Sequence; same for both SEQRES and ATOM records:

>d4ksob_ c.47.1.15 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]}
msprktyilklyvagntpnsvralktlknilevefqgvyalkvidvlknpqlaeedkila
tptlakvlplpvrriigdlsdrekvligldllygelqdsddf

Timeline for d4ksob_:

• d4ksob_ is new in SCOPe 2.03-stable
  
• d4ksob_ appears in SCOPe 2.04
  
• d4ksob_ appears in the current release, SCOPe 2.08