SCOPe 2.03: Domain d4kqrb2: 4kqr B:222-570

Lineage for d4kqrb2 (4kqr B:222-570)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (15 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [196777] (9 PDB entries)

8. Domain d4kqrb2: 4kqr B:222-570 [235216]
   Other proteins in same PDB: d4kqra1, d4kqrb1
   automated match to d4kqoa2
   complexed with cl, gol, imd, vpp

Details for d4kqrb2

PDB Entry: 4kqr, 2.01 Å

PDB Description: crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with (5s)-penicilloic acid

PDB Compounds: (B:) penicillin-binding protein 3

SCOPe Domain Sequences for d4kqrb2:

Sequence; same for both SEQRES and ATOM records:

>d4kqrb2 e.3.1.0 (B:222-570) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam
rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld
ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae
tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml
qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenayrslfagfapatdpriamv
vvidepskagyfgglvsapvfskvmagalrlmnvppdnlptateqqqvn

Timeline for d4kqrb2:

• d4kqrb2 is new in SCOPe 2.03-stable
  
• d4kqrb2 appears in SCOPe 2.04
  
• d4kqrb2 appears in the current release, SCOPe 2.08